PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC4711_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family HB-other
Protein Properties Length: 869aa    MW: 96569.5 Da    PI: 7.1262
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC4711_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox18.43.6e-0651107157
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                 +r+R  ++++ ++ ++++F+ +  +s++e +e+++  g++ +qV+ +F  +++k kk
  RrC4711_p1  51 KRPRDLLNPKAVKYMQTVFAIKDSISKKESREISALFGISVAQVRDFFATQKIKVKK 107
                 799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.15148108IPR001356Homeobox domain
SMARTSM003892.2E-450112IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-451114IPR009057Homeodomain-like
CDDcd000868.79E-451108No hitNo description
SuperFamilySSF466892.44E-551116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 869 aa     Download sequence    Send to blast
MDDAFKEEIE IGSSVESLME LLNSQKMIFH SQIDQLQDVV AAGALSIKIG KRPRDLLNPK  60
AVKYMQTVFA IKDSISKKES REISALFGIS VAQVRDFFAT QKIKVKKQVR LSREKLMMST  120
THAIQGDGVM EQNSAVPHAE PLPLNSMDPE ASSISWGEGE TPALMPKEDV QEEDVPPDIS  180
DSDKYFVDNI FSLLRREETF LGQMKLMEWI MQIQDSSVLI WFLSKGGVLI LTTWLSQAAT  240
EEQTSVLLLI LKVLCHLPLH KASPENIIAE IMGDKTNPED ILSISNGRSE NGRRLKSSQG  300
PKLLLTSADD STRKHMLGST PSYNKERRKV QMVEQPGQKA AGRGPQTVRI GTSGRSRPMS  360
ADDIQKAKMR ALYMNSKNIK KDTLPSAIGD TRTVVPEKPL AIQSVKDSPP SQSNEAKTEN  420
TPEPSAVQFP PSQNNEAKTE DKPEPSAVQQ PVTVNVLVQP VSSPAVNVPV QADEFRNRKL  480
STPPKSISSK VGVLSRMSPQ TILKNCKREQ IEWHVPPGMV LDELWRVAAG ANSKEADVQK  540
NRNRREKETT YQSLQTIPLN PKEPWDRELD FDDSLTPEIP SQQPQEESIT EPQDSLDERR  600
TAAGAASTSS SQSSSVEPDY ELLAALLKNP DLLHALTSGQ PGNLAGQDMV KLLDVIKTGA  660
PNLSSSSNMK VDEQVEVSLP SPTPSTNPGM SGWGQEVTRN PFSRQTQVGA SVARMSTRLP  720
VASMQWQPSN GQSIPQHTPS AYNSFTLPHT ERQHQQRMQP RLHQNQHLQQ QPISTTSYVV  780
RESVGKMDIG TSASWRSQQS QNSYYSHQAN GIGSDASYQG NEQYMTSSNP GYESWSPDNS  840
PSRNHPNMRG QQQPSRKHDP YWNQNKRWR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2267460.0AK226746.1 Arabidopsis thaliana mRNA for luminidependens protein, complete cds, clone: RAFL07-75-C15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013621060.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
RefseqXP_013722738.10.0PREDICTED: homeobox protein LUMINIDEPENDENS-like
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A0D3ASF50.0A0A0D3ASF5_BRAOL; Uncharacterized protein
STRINGBra018540.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein